PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.395170.1
Common NameCsa_2G351760, LOC101204223
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family TALE
Protein Properties Length: 487aa    MW: 54636.1 Da    PI: 6.1933
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.395170.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.11.5e-084164541854
                     HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     +F++  ++yp+ +e+  LA k gLt +qV++WF N R +
  Cucsa.395170.1 416 MFQNflHPYPKDTEKHLLAVKSGLTRNQVSNWFINARVR 454
                     6887779******************************88 PP

2BELL63.64.1e-21291355570
            BELL   5 lqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiae 70 
                     + +kk++Ll+ll+ +d+rY q+ ++++tv s+F+a+++l++ +++t+  l++i+  +++L+++i++
  Cucsa.395170.1 291 VDAKKSHLLTLLQLIDERYTQCLDEIHTVTSAFHAATDLDP-RLHTRYTLQTITSVYKNLREKITS 355
                     679**************************************.**********************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.6E-14212355IPR006563POX domain
PfamPF075268.3E-22218354IPR006563POX domain
PROSITE profilePS5007111.175395458IPR001356Homeobox domain
SMARTSM003898.7E-5398462IPR001356Homeobox domain
CDDcd000869.09E-10398459No hitNo description
SuperFamilySSF466892.52E-15399467IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-25401464IPR009057Homeodomain-like
PfamPF059202.1E-14415454IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009640Biological Processphotomorphogenesis
GO:0010073Biological Processmeristem maintenance
GO:0010227Biological Processfloral organ abscission
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010371Biological Processregulation of gibberellin biosynthetic process
GO:0090470Biological Processshoot organ boundary specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 487 aa     Download sequence    Send to blast
MSTALQRIDM GDACLGPSGN AEFQNQLAVA IPISLFQSTS LAPVNDIRGN IKDSAFPDPQ  60
FQQLETFRTC FLHSYSNASN SSFASSLICE GDESLCNANN KWESDRFHCI QQLSGENPET  120
SDSQTVLSME HLHQNGWMSS NTMNSKLWNE LSLSLATTEP VLSGGTDFLD QYSQLTFSGA  180
TQPCLNSTEL ASNLNSGSSR DLSLSYGCGN SVRLSRAIAG SRYLSVIQDV LSQIASYPLE  240
NSDQVDHSTT ATGFVPLSSS SSLDDATIEY GSDVTGRYSS QMEPEWQNLS VDAKKSHLLT  300
LLQLIDERYT QCLDEIHTVT SAFHAATDLD PRLHTRYTLQ TITSVYKNLR EKITSCIFAI  360
GKHSNATCTK EKEKFFEATF LQKQWALQQL KRKDNQLWRP QRGLPEKSVS VLRAWMFQNF  420
LHPYPKDTEK HLLAVKSGLT RNQVSNWFIN ARVRLWKPMI EEMYAEMSRR KSNQNEEGIE  480
RIHCPR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A1e-14404462563Homeobox protein Meis2
3k2a_B1e-14404462563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818230.0LN681823.1 Cucumis melo genomic scaffold, anchoredscaffold00014.
GenBankLN7132570.0LN713257.1 Cucumis melo genomic chromosome, chr_3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011649540.10.0PREDICTED: homeobox protein ATH1
RefseqXP_011649539.10.0PREDICTED: homeobox protein ATH1
RefseqXP_011649538.10.0PREDICTED: homeobox protein ATH1
RefseqXP_011649537.10.0PREDICTED: homeobox protein ATH1
RefseqXP_004143038.10.0PREDICTED: homeobox protein ATH1
RefseqXP_011649536.10.0PREDICTED: homeobox protein ATH1
RefseqXP_011649535.10.0PREDICTED: homeobox protein ATH1
SwissprotP487312e-99ATH1_ARATH; Homeobox protein ATH1
TrEMBLA0A0A0LKF30.0A0A0A0LKF3_CUCSA; Uncharacterized protein
STRINGVIT_04s0008g00880.t011e-145(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59393249
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.11e-100homeobox gene 1
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]